Protein Info for Rv2877c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 6 to 33 (28 residues), see Phobius details amino acids 53 to 78 (26 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details amino acids 167 to 192 (26 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 99% identity to mbo:Mb2902c)

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.1.1.267)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.267

Use Curated BLAST to search for 1.1.1.267

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>Rv2877c Probable conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
VNEALIGLAFAAGLVAALNPCGFAMLPAYLLLVVYGQDSAGRTGPLSAVGRAAAATVGMA
LGFLTVFGIFGALTISAATAVQRYLPYATVLIGLALIALGGWLLLGRGLTALTPRSLGVR
WAPTVRLGSMYGYGISYAVASLSCTIGPFLAVTGAGLRGGSVVGSVAIYLAYVAGLTLVV
GVLAVAAATASSALADRLRRILPFVNRISGALLVVVGLYVGYYGLYELRLIAGVGANPQD
AVIAAAGRLQGALAGWVNQHGAWPWAVLLVVLVVGAFAGTWFRRVRR