Protein Info for Rv2869c in Mycobacterium tuberculosis H37Rv

Annotation: Membrane bound metalloprotease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 98 to 123 (26 residues), see Phobius details amino acids 313 to 335 (23 residues), see Phobius details amino acids 376 to 397 (22 residues), see Phobius details PF02163: Peptidase_M50" amino acids 10 to 374 (365 residues), 187.4 bits, see alignment E=2.4e-59 PF17820: PDZ_6" amino acids 157 to 201 (45 residues), 34.2 bits, see alignment 1.7e-12

Best Hits

Swiss-Prot: 100% identical to RIP1_MYCTE: Zinc metalloprotease Rip1 (rip1) from Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman)

KEGG orthology group: K01417, [EC: 3.4.24.-] (inferred from 100% identity to mbb:BCG_2891c)

Predicted SEED Role

"Membrane-associated zinc metalloprotease" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>Rv2869c Membrane bound metalloprotease (Mycobacterium tuberculosis H37Rv)
MMFVTGIVLFALAILISVALHECGHMWVARRTGMKVRRYFVGFGPTLWSTRRGETEYGVK
AVPLGGFCDIAGMTPVEELDPDERDRAMYKQATWKRVAVLFAGPGMNLAICLVLIYAIAL
VWGLPNLHPPTRAVIGETGCVAQEVSQGKLEQCTGPGPAALAGIRSGDVVVKVGDTPVSS
FDEMAAAVRKSHGSVPIVVERDGTAIVTYVDIESTQRWIPNGQGGELQPATVGAIGVGAA
RVGPVRYGVFSAMPATFAVTGDLTVEVGKALAALPTKVGALVRAIGGGQRDPQTPISVVG
ASIIGGDTVDHGLWVAFWFFLAQLNLILAAINLLPLLPFDGGHIAVAVFERIRNMVRSAR
GKVAAAPVNYLKLLPATYVVLVLVVGYMLLTVTADLVNPIRLFQ