Protein Info for Rv2845c in Mycobacterium tuberculosis H37Rv

Annotation: Probable prolyl-tRNA synthetase ProS (proline--tRNA ligase) (PRORS) (global RNA synthesis factor) (proline translase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 TIGR00409: proline--tRNA ligase" amino acids 4 to 566 (563 residues), 542.4 bits, see alignment E=8.1e-167 PF00587: tRNA-synt_2b" amino acids 96 to 471 (376 residues), 90 bits, see alignment E=3.2e-29 PF04073: tRNA_edit" amino acids 280 to 390 (111 residues), 54.6 bits, see alignment E=1.7e-18 PF03129: HGTP_anticodon" amino acids 490 to 565 (76 residues), 48.8 bits, see alignment E=9.8e-17

Best Hits

Swiss-Prot: 100% identical to SYP_MYCTU: Proline--tRNA ligase (proS) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01881, prolyl-tRNA synthetase [EC: 6.1.1.15] (inferred from 100% identity to mra:MRA_2868)

Predicted SEED Role

"Prolyl-tRNA synthetase (EC 6.1.1.15), bacterial type" (EC 6.1.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (582 amino acids)

>Rv2845c Probable prolyl-tRNA synthetase ProS (proline--tRNA ligase) (PRORS) (global RNA synthesis factor) (proline translase) (Mycobacterium tuberculosis H37Rv)
VITRMSELFLRTLRDDPADAEVASHKLLIRAGYIRPVAPGLYSWLPLGLRVLRNIERVIR
DEMNAIGGQEILFPALLPRAPYETTNRWTQYGDSVFRLKDRRGNDYLLGPTHEELFTLTV
KGEYSSYKDFPLTLYQIQTKYRDEARPRAGILRAREFVMKDSYSFDIDAAGLKAAYHAHR
EAYQRIFDRLQVRYVIVSAVSGAMGGSASEEFLAESPSGEDAFVRCLESGYAANVEAVVT
ARPDTLPIDGLPEAVVHDTGDTPTIASLVAWANEADLGRTVTAADTLKNVLIKVRQPGGD
TELLAIGVPGDREVDDKRLGAALEPADYALLDDDDFAKHPFLVKGYIGPKALRENNVRYL
VDPRIVDGTSWITGADQPGRHVVGLVAGRDFTADGTIEAAEVREGDPSPDGAGPLVMARG
IEIGHIFQLGSKYTDAFTADVLGEDGKPVRLTMGSYGIGVSRLVAVVAEQHHDELGLRWP
STVAPFDVHLVIANKDAQARAGATALAADLDRLGVEVLLDDRQASPGVKFKDAELLGMPW
IVVVGRGWADGVVELRDRFSGQTRELVAGASLATDIAAAVTG