Protein Info for Rv2833c in Mycobacterium tuberculosis H37Rv

Annotation: Probable Sn-glycerol-3-phosphate-binding lipoprotein UgpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF01547: SBP_bac_1" amino acids 50 to 335 (286 residues), 133.5 bits, see alignment E=1.6e-42 PF13416: SBP_bac_8" amino acids 60 to 356 (297 residues), 138.4 bits, see alignment E=4.2e-44

Best Hits

KEGG orthology group: K05813, sn-glycerol 3-phosphate transport system substrate-binding protein (inferred from 100% identity to mtb:TBMG_01139)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, periplasmic glycerol-3-phosphate-binding protein (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>Rv2833c Probable Sn-glycerol-3-phosphate-binding lipoprotein UgpB (Mycobacterium tuberculosis H37Rv)
MDPLNRRQFLALAAAAAGVTAGCAGMGGGGSVKSGSGPIDFWSSHPGQSSAAERELIGRF
QDRFPTLSVKLIDAGKDYDEVAQKFNAALIGTDVPDVVLLDDRWWFHFALSGVLTALDDL
FGQVGVDTTDYVDSLLADYEFNGRHYAVPYARSTPLFYYNKAAWQQAGLPDRGPQSWSEF
DEWGPELQRVVGAGRSAHGWANADLISWTFQGPNWAFGGAYSDKWTLTLTEPATIAAGNF
YRNSIHGKGYAAVANDIANEFATGILASAVASTGSLAGITASARFDFGAAPLPTGPDAAP
ACPTGGAGLAIPAKLSEERKVNALKFIAFVTNPTNTAYFSQQTGYLPVRKSAVDDASERH
YLADNPRARVALDQLPHTRTQDYARVFLPGGDRIISAGLESIGLRGADVTKTFTNIQKRL
QVILDRQIMRKLAGHG