Protein Info for Rv2698 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved alanine rich transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 48 to 66 (19 residues), see Phobius details PF11292: DUF3093" amino acids 12 to 159 (148 residues), 180.5 bits, see alignment E=1.1e-57

Best Hits

KEGG orthology group: None (inferred from 99% identity to mbb:BCG_2711)

Predicted SEED Role

"FIG01105974: Probable conserved alanine rich transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>Rv2698 Probable conserved alanine rich transmembrane protein (Mycobacterium tuberculosis H37Rv)
VSGTRLAPHSVRYRERLWVPWWWWPLAFALAALIAFEVNLGVAALPDWVPFATLFTVAAG
TLLWLGRVEIRVTAGSADGAGVKLWAGPAHLPVAVIARSAEIPATAKSAALGRQLDPAAY
VLHRAWVGPMVLVVLDDPNDPTPYWLVSCRHPERVLSALRS