Protein Info for Rv2689c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved alanine and valine and glycine rich protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 PF01938: TRAM" amino acids 16 to 60 (45 residues), 27 bits, see alignment 3.3e-10 PF05958: tRNA_U5-meth_tr" amino acids 332 to 404 (73 residues), 30.9 bits, see alignment E=1.6e-11

Best Hits

Swiss-Prot: 41% identical to Y1398_CORDI: Uncharacterized RNA methyltransferase DIP1398 (DIP1398) from Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)

KEGG orthology group: K00599, [EC: 2.1.1.-] (inferred from 100% identity to mbt:JTY_2696)

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>Rv2689c Conserved alanine and valine and glycine rich protein (Mycobacterium tuberculosis H37Rv)
VTRAGDDAVNLTLVTGAPANGGSCVAHHEGRVVFVRYALPGERVRARVTAQRGSYWHAEA
FEVIDPSPDRIGSLCSIAGADGAGCCDLAFAAPEAARTLKAQVVANQLERLGRHSWQGEA
QPLSDAGPTGWRIRVRLDVGADRRPGFHRYHSGELVTDLDCGQLPVGMLDGLVAADWPPE
AQLYVALDDDGERHVVCSVRQGPRNRTRTVTNVVEGAYHAHQRVHRRSWRVPVTAFWQAH
RDAAAVYSDLIADWAQPAPGMTAWDLYGGAGVFAAVLGEAVGESGRVLTVDTSRLASGAA
RAALVDLPQVEVVTGSVRRVLAVQPAGADLAVLDPPRSGAGREVVDLLAGAGVPRLIHIG
CEAASFARDIGLYRGHGYAVEKIKVFDAFPLTHYVECVALLTRKV