Protein Info for Rv2688c in Mycobacterium tuberculosis H37Rv

Annotation: Antibiotic-transport ATP-binding protein ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 PF00005: ABC_tran" amino acids 36 to 175 (140 residues), 88.6 bits, see alignment E=6e-29 PF13304: AAA_21" amino acids 147 to 208 (62 residues), 34.9 bits, see alignment E=1.7e-12

Best Hits

Swiss-Prot: 100% identical to FLQE1_MYCTU: Fluoroquinolones export ATP-binding protein Rv2688c (Rv2688c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K09687, antibiotic transport system ATP-binding protein (inferred from 100% identity to mtb:TBMG_01285)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>Rv2688c Antibiotic-transport ATP-binding protein ABC transporter (Mycobacterium tuberculosis H37Rv)
MTALNRAVASARVGTEVIRVRGLTFRYPKAAEPAVRGMEFTVGRGEIFGLLGPSGAGKST
TQKLLIGLLRDHGGQATVWDKEPAEWGPDYYERIGVSFELPNHYQKLTGYENLRFFASLY
AGATADPMQLLAAVGLADDAHTLVGKYSKGMQMRLPFARSLINDPELLFLDEPTSGLDPV
NARKIKDIIVDLKARGRTIFLTTHDMATADELCDRVAFVVDGRIVALDSPTELKIARSRR
RVRVEYRGDGGGLETAEFGMDGLADDPAFHSVLRNHHVETIHSREASLDDVFVEVTGRQL
T