Protein Info for Rv2686c in Mycobacterium tuberculosis H37Rv

Annotation: Antibiotic-transport integral membrane leucine and alanine and valine rich protein ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 66 to 92 (27 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 144 to 169 (26 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details

Best Hits

Swiss-Prot: 100% identical to FLQE2_MYCTU: Fluoroquinolones export permease protein Rv2686c (Rv2686c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_12701)

Predicted SEED Role

"D-alanyl-D-alanine carboxypeptidase (EC 3.4.16.4)" in subsystem Peptidoglycan Biosynthesis (EC 3.4.16.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.16.4

Use Curated BLAST to search for 3.4.16.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>Rv2686c Antibiotic-transport integral membrane leucine and alanine and valine rich protein ABC transporter (Mycobacterium tuberculosis H37Rv)
VRAISSLAGPRALAAFGRNDIRGTYRDPLLVMLVIAPVIWTTGVALLTPLFTEMLARRYG
FDLVGYYPLILTAFLLLTSIIVAGALAAFLVLDDVDAGTMTALRVTPVPLSVFFGYRAAT
VMVVTTIYVVATMSCSGILEPGLVSSLIPIGLVAGLSAVVTLLLILAVANNKIQGLAMVR
ALGMLIAGLPCLPWFISSNWNLAFGVLPPYWAAKAFWVASDHGTWWPYLVGGAVYNLAIV
WVLFRRFRAKHA