Protein Info for Rv2682c in Mycobacterium tuberculosis H37Rv

Annotation: Probable 1-deoxy-D-xylulose 5-phosphate synthase Dxs1 (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13292: DXP_synthase_N
  • amino acids 2 to 278 (277 residues), 362.9 bits, E=2.1e-112
• TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase
  • amino acids 4 to 620 (617 residues), 624.9 bits, E=7.8e-192
• PF02775: TPP_enzyme_C
  • amino acids 106 to 174 (69 residues), 22.6 bits, E=1.6e-08
• PF02779: Transket_pyr
  • amino acids 315 to 476 (162 residues), 153.6 bits, E=8.7e-49
• PF02780: Transketolase_C
  • amino acids 500 to 612 (113 residues), 91.7 bits, E=6.9e-30

Best Hits

Swiss-Prot: 100% identical to DXS_MYCBP: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Mycobacterium bovis (strain BCG / Pasteur 1173P2)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 100% identity to mtf:TBFG_12697)

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (12/12 steps found)
• taxadiene biosynthesis (engineered) (12/13 steps found)
• methylerythritol phosphate pathway I (9/9 steps found)
• methylerythritol phosphate pathway II (9/9 steps found)
• superpathway of thiamine diphosphate biosynthesis II (10/11 steps found)
• isoprene biosynthesis I (9/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (6/7 steps found)
• superpathway of thiamine diphosphate biosynthesis I (8/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (4/6 steps found)
• pyridoxal 5'-phosphate biosynthesis I (4/7 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (5/12 steps found)
• superpathway of ergosterol biosynthesis II (13/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.7

Use Curated BLAST to search for 2.2.1.7

Protein Sequence (638 amino acids)

>Rv2682c Probable 1-deoxy-D-xylulose 5-phosphate synthase Dxs1 (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) (Mycobacterium tuberculosis H37Rv)
MLQQIRGPADLQHLSQAQLRELAAEIREFLIHKVAATGGHLGPNLGVVELTLALHRVFDS
PHDPIIFDTGHQAYVHKMLTGRSQDFATLRKKGGLSGYPSRAESEHDWVESSHASAALSY
ADGLAKAFELTGHRNRHVVAVVGDGALTGGMCWEALNNIAASRRPVIIVVNDNGRSYAPT
IGGVADHLATLRLQPAYEQALETGRDLVRAVPLVGGLWFRFLHSVKAGIKDSLSPQLLFT
DLGLKYVGPVDGHDERAVEVALRSARRFGAPVIVHVVTRKGMGYPPAEADQAEQMHSTVP
IDPATGQATKVAGPGWTATFSDALIGYAQKRRDIVAITAAMPGPTGLTAFGQRFPDRLFD
VGIAEQHAMTSAAGLAMGGLHPVVAIYSTFLNRAFDQIMMDVALHKLPVTMVLDRAGITG
SDGASHNGMWDLSMLGIVPGIRVAAPRDATRLREELGEALDVDDGPTALRFPKGDVGEDI
SALERRGGVDVLAAPADGLNHDVLLVAIGAFAPMALAVAKRLHNQGIGVTVIDPRWVLPV
SDGVRELAVQHKLLVTLEDNGVNGGAGSAVSAALRRAEIDVPCRDVGLPQEFYEHASRSE
VLADLGLTDQDVARRITGWVAALGTGVCASDAIPEHLD