Protein Info for Rv2652c in Mycobacterium tuberculosis H37Rv

Annotation: Probable PhiRv2 prophage protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 TIGR01558: putative phage terminase, small subunit, P27 family" amino acids 88 to 204 (117 residues), 70.2 bits, see alignment E=7.1e-24 PF05119: Terminase_4" amino acids 96 to 188 (93 residues), 79.7 bits, see alignment E=9.3e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_01321)

Predicted SEED Role

"Probable phiRv1 phage protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>Rv2652c Probable PhiRv2 prophage protein (Mycobacterium tuberculosis H37Rv)
LPSPATARPDTATVGERVRAQVLWGVFWHHGIRDPKPGKRRVVLKMGRRGPAPAPAQLKL
LGGRSPGRDSGGRRVTPPAAFERVAPECPDWLPPGAKDMWGRVVPELAALNLLKESDLGV
LTSFCVAWDQLMQAVTAYREQGFIATNARSRRVTVHPAVAAARAATRDVLVLARELGCTP
SAEANLAAVLAAAGDPDDDEFNPFAPDR