Protein Info for Rv2625c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved transmembrane alanine and leucine rich protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 10 to 33 (24 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 108 to 131 (24 residues), see Phobius details amino acids 137 to 161 (25 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details PF02163: Peptidase_M50" amino acids 56 to 132 (77 residues), 47 bits, see alignment E=2.1e-16 amino acids 139 to 198 (60 residues), 42.6 bits, see alignment E=4.8e-15 PF00571: CBS" amino acids 311 to 367 (57 residues), 21 bits, see alignment E=3.5e-08

Best Hits

Swiss-Prot: 100% identical to RIP3_MYCTO: Putative zinc metalloprotease Rip3 (rip3) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mra:MRA_2653)

Predicted SEED Role

"PROBABLE CONSERVED TRANSMEMBRANE ALANINE AND LEUCINE RICH PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>Rv2625c Probable conserved transmembrane alanine and leucine rich protein (Mycobacterium tuberculosis H37Rv)
MRDAIPLGRIAGFVVNVHWSVLVILWLFTWSLATMLPGTVGGYPAVVYWLLGAGGAVMLL
ASLLAHELAHAVVARRAGVSVESVTLWLFGGVTALGGEAKTPKAAFRIAFAGPATSLALS
ATFGALAITLAGVRTPAIVISVAWWLATVNLLLGLFNLLPGAPLDGGRLVRAYLWRRHGD
SVRAGIGAARAGRVVALVLIALGLAEFVAGGLVGGVWLAFIGWFIFAAAREEETRISTQQ
LFAGVRVADAMTAQPHTAPGWINVEDFIQRYVLGERHSAYPVADRDGSITGLVALRQLRD
VAPSRRSTTSVGDIALPLHSVPTARPQEPLTALLERMAPLGPRSRALVTEGSAVVGIVTP
SDVARLIDVYRLAQPEPTFTTSPQDADRFSDAG