Protein Info for Rv2600 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 72 to 97 (26 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details PF03994: DUF350" amino acids 7 to 61 (55 residues), 47.1 bits, see alignment E=1e-16 amino acids 78 to 132 (55 residues), 43.2 bits, see alignment E=1.6e-15

Best Hits

Swiss-Prot: 100% identical to Y2600_MYCTO: UPF0719 transmembrane protein MT2674.1 (MT2674.1) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 99% identity to mtu:Rv2600)

Predicted SEED Role

"PROBABLE CONSERVED INTEGRAL MEMBRANE PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (133 amino acids)

>Rv2600 Probable conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
VVATVLYFLVGAAVLVAGFLMVNLLTPGDLRRLVFIDRRPNAVVLAATMYVALAIVTIAA
IYASSNQLAQGLIGVAVYGIVGVALQGVALVILEIAVPGRFREHIDAPALHPAVFATAVM
LLAVAGVIAAALS