Protein Info for Rv2559c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved hypothetical alanine leucine valine rich protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 PF05496: RuvB_N" amino acids 35 to 153 (119 residues), 48 bits, see alignment E=4.7e-16 PF14532: Sigma54_activ_2" amino acids 66 to 177 (112 residues), 27.9 bits, see alignment E=1.1e-09 PF07728: AAA_5" amino acids 68 to 159 (92 residues), 33.5 bits, see alignment E=1.6e-11 PF00004: AAA" amino acids 68 to 171 (104 residues), 54.9 bits, see alignment E=5.4e-18 PF16193: AAA_assoc_2" amino acids 202 to 277 (76 residues), 88 bits, see alignment E=1.6e-28 PF12002: MgsA_C" amino acids 278 to 443 (166 residues), 223.9 bits, see alignment E=4.8e-70

Best Hits

Swiss-Prot: 100% identical to Y2559_MYCTU: Uncharacterized AAA domain-containing protein Rv2559c (Rv2559c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K07478, putative ATPase (inferred from 100% identity to mbo:Mb2589c)

Predicted SEED Role

"ATPase, AAA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>Rv2559c Conserved hypothetical alanine leucine valine rich protein (Mycobacterium tuberculosis H37Rv)
MPEAVSDGLFDVPGVPMTSGHDLGASAGAPLAVRMRPASLDEVVGQDHLLAPGSPLRRLV
EGSGVASVILYGPPGSGKTTLAALISQATGRRFEALSALSAGVKEVRAVIENSRKALLHG
EQTVLFIDEVHRFSKTQQDALLSAVEHRVVLLVAATTENPSFSVVAPLLSRSLILQLRPL
TAEDTRAVVQRAIDDPRGLGRAVAVAPEAVDLLVQLAAGDARRALTALEVAAEAAQAAGE
LVSVQTIERSVDKAAVRYDRDGDQHYDVVSAFIKSVRGSDVDAALHYLARMLVAGEDPRF
IARRLMILASEDIGMAGPSALQVAVAAAQTVALIGMPEAQLTLAHATIHLATAPKSNAVT
TALAAAMNDIKAGKAGLVPAHLRDGHYSGAAALGNAQGYKYSHDDPDGVVAQQYPPDELV
DVDYYRPTGRGGEREIAGRLDRLRAIIRKKRG