Protein Info for Rv2528c in Mycobacterium tuberculosis H37Rv

Annotation: Probable restriction system protein Mrr

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF14338: Mrr_N" amino acids 7 to 91 (85 residues), 100.8 bits, see alignment E=7.6e-33 PF04471: Mrr_cat" amino acids 162 to 280 (119 residues), 129.4 bits, see alignment E=1.5e-41 PF22722: NA-iREase1" amino acids 169 to 277 (109 residues), 41.9 bits, see alignment E=1.8e-14 PF13156: Mrr_cat_2" amino acids 190 to 283 (94 residues), 27.8 bits, see alignment E=4.2e-10

Best Hits

KEGG orthology group: K07448, restriction system protein (inferred from 100% identity to mbb:BCG_2549c)

Predicted SEED Role

"Mrr restriction system protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>Rv2528c Probable restriction system protein Mrr (Mycobacterium tuberculosis H37Rv)
MTIPDAQTLMRPILAYLADGQAKSAKDVIAAMSDEFGLSDDERAQMLPSGRQRTMYDRVH
WSLTHMSQAGLLDRPTRGHVQVTDTGRQVLKAHPERVDMAVLREFPSYIAFRERTKAKQP
VDATAKRPSGDDVQVSPEDLIDAALAENRAAVEGEILKKALTLSPTGFEDLVIRLLEAMG
YGRAGAVERTSASGDAGIDGIISQDPLGLDRIYVQAKRYAVDQTIGRPKIHEFAGALLGK
QGDRGVYITTSSFSRGAREEAERINARIELIDGARLAELLVRYRVGVQAVQTVELLRLDE
DFFDGL