Protein Info for Rv2510c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 transmembrane" amino acids 264 to 281 (18 residues), see Phobius details PF05872: HerA_C" amino acids 38 to 532 (495 residues), 740.1 bits, see alignment E=1.8e-226 PF01935: DUF87" amino acids 42 to 97 (56 residues), 30.6 bits, see alignment 5.7e-11 PF10412: TrwB_AAD_bind" amino acids 43 to 93 (51 residues), 21.6 bits, see alignment 1.4e-08

Best Hits

KEGG orthology group: K06915, (no description) (inferred from 100% identity to mtb:TBMG_01461)

Predicted SEED Role

"ATPase component BioM of energizing module of biotin ECF transporter" in subsystem Biotin biosynthesis or ECF class transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (533 amino acids)

>Rv2510c Conserved protein (Mycobacterium tuberculosis H37Rv)
MGTESAAGGPGGPAQRIAAGYTVEGQALQLGTVVVDGEPDPSAQIRIPLATVNRHGLVAG
ATGTGKTKTLQLIAEQLSAAGVAVLMADVKGDLSGLARPGEAADKTAARAKDTGDDWVPT
AFPVEFLSLGASGVGVPVRATISSFGPILLAKVLGLNATQESTLGLIFHWADQRGLPLLD
LKDLRAVITHLTSDEGKVELKSLGAVSPTTAGVILRALVNLEAEGADTFFGEPELRPEDL
LRVDSQGRGIISLLEFGSQALRPAMFSTFLMWVLADLFTFLPEVGDLDKPKLVFFFDEAH
LLFTDASKAFLEQVEQTVKLIRSKGVGVFFCTQLPTDLPNDVLSQLGARIQHALRAFTPD
DHKALRKTVRTYPKTDVYDLESALTSLGTGEAVVTVLSEKGAPTPVAWTRMRAPRSLMAA
IGAEAIGAAAQASSLQAVYGQTIDRPSAHEILSAKLAPAQEAPAQEAPAPRGQYDPLPWP
DDFEVPPMPAPVEPQGPAVWEEILKNPTVKSVLNTTAREITRSIFGTGRRRRK