Protein Info for Rv2477c in Mycobacterium tuberculosis H37Rv

Annotation: Probable macrolide-transport ATP-binding protein ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 TIGR03719: ATP-binding cassette protein, ChvD family" amino acids 3 to 555 (553 residues), 894.9 bits, see alignment E=2.1e-273 PF00005: ABC_tran" amino acids 21 to 188 (168 residues), 93.4 bits, see alignment E=2.9e-30 amino acids 338 to 471 (134 residues), 80.4 bits, see alignment E=3e-26 PF12848: ABC_tran_Xtn" amino acids 227 to 306 (80 residues), 53.4 bits, see alignment E=3.4e-18

Best Hits

Swiss-Prot: 100% identical to ETTA_MYCTU: Energy-dependent translational throttle protein EttA (ettA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mra:MRA_2502)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (558 amino acids)

>Rv2477c Probable macrolide-transport ATP-binding protein ABC transporter (Mycobacterium tuberculosis H37Rv)
MAEFIYTMKKVRKAHGDKVILDDVTLSFYPGAKIGVVGPNGAGKSSVLRIMAGLDKPNNG
DAFLATGATVGILQQEPPLNEDKTVRGNVEEGMGDIKIKLDRFNEVAELMATDYTDELME
EMGRLQEELDHADAWDLDAQLEQAMDALRCPPADEPVTNLSGGERRRVALCKLLLSKPDL
LLLDEPTNHLDAESVQWLEQHLASYPGAILAVTHDRYFLDNVAEWILELDRGRAYPYEGN
YSTYLEKKAERLAVQGRKDAKLQKRLTEELAWVRSGAKARQAKSKARLQRYEEMAAEAEK
TRKLDFEEIQIPVGPRLGNVVVEVDHLDKGYDGRALIKDLSFSLPRNGIVGVIGPNGVGK
TTLFKTIVGLETPDSGSVKVGETVKLSYVDQARAGIDPRKTVWEVVSDGLDYIQVGQTEV
PSRAYVSAFGFKGPDQQKPAGVLSGGERNRLNLALTLKQGGNLILLDEPTNDLDVETLGS
LENALLNFPGCAVVISHDRWFLDRTCTHILAWEGDDDNEAKWFWFEGNFGAYEENKVERL
GVDAARPHRVTHRKLTRG