Protein Info for Rv2464c in Mycobacterium tuberculosis H37Rv

Annotation: Possible DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 PF01149: Fapy_DNA_glyco" amino acids 2 to 94 (93 residues), 31.1 bits, see alignment E=4.9e-11 PF06831: H2TH" amino acids 126 to 214 (89 residues), 96.4 bits, see alignment E=1.2e-31 PF06827: zf-FPG_IleRS" amino acids 240 to 267 (28 residues), 25.7 bits, see alignment (E = 1.2e-09)

Best Hits

Swiss-Prot: 100% identical to END8A_MYCTU: Endonuclease 8 1 (nei1) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K05522, endonuclease VIII [EC: 3.2.2.- 4.2.99.18] (inferred from 99% identity to mtb:TBMG_01509)

Predicted SEED Role

"Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23)" in subsystem DNA Repair Base Excision (EC 3.2.2.23)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-, 3.2.2.23, 4.2.99.18

Use Curated BLAST to search for 3.2.2.- or 3.2.2.23 or 4.2.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>Rv2464c Possible DNA glycosylase (Mycobacterium tuberculosis H37Rv)
VPEGHTLHRLARLHQRRFAGAPVSVSSPQGRFADSASALNGRVLRRASAWGKHLFHHYVG
GPVVHVHLGLYGTFTEWARPTDGWLPEPAGQVRMRMVGAEFGTDLRGPTVCESIDDGEVA
DVVARLGPDPLRSDANPSSAWSRITKSRRPIGALLMDQTVIAGVGNVYRNELLFRHRIDP
QRPGRGIGEPEFDAAWNDLVSLMKVGLRRGKIIVVRPEHDHGLPSYLPDRPRTYVYRRAG
EPCRVCGGVIRTALLEGRNVFWCPVCQT