Protein Info for Rv2456c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 47 to 70 (24 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 290 to 307 (18 residues), see Phobius details amino acids 313 to 336 (24 residues), see Phobius details amino acids 348 to 373 (26 residues), see Phobius details amino acids 379 to 398 (20 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 344 (324 residues), 116.2 bits, see alignment E=1.6e-37 amino acids 263 to 409 (147 residues), 46.2 bits, see alignment E=3.1e-16 PF12832: MFS_1_like" amino acids 30 to 372 (343 residues), 56.2 bits, see alignment E=3.4e-19

Best Hits

Swiss-Prot: 100% identical to Y2456_MYCTU: Uncharacterized MFS-type transporter Rv2456c (Rv2456c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_2470)

Predicted SEED Role

"Integral membrane transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>Rv2456c Probable conserved integral membrane transport protein (Mycobacterium tuberculosis H37Rv)
MSGTVVAVPPRVARALDLLNFSLADVRDGLGPYLSIYLLLIHDWDQASIGFVMAVGGIAA
IVAQTPIGALVDRTTAKRALVVAGAVLVTAAAVAMPLFAGLYSISVLQAVTGIASSVFAP
ALAAITLGAVGPQFFARRIGRNEAFNHAGNASAAGATGALAYFFGPVVVFWVLAGMALIS
VLATLRIPPDAVDHDLARGMDHAPGEPHPQPSRFTVLAHNRELVIFGAAVVAFHFANAAM
LPLVGELLALHNRDEGTALMSSCIVAAQVVMVPVAYVVGTRADAWGRKPIFLVGFAVLTA
RGFLYTLSDNSYWLVGVQLLDGIGAGIFGALFPLVVQDVTHGTGHFNISLGAVTTATGIG
AALSNLVAGWIVVVAGYDAAFMSLGALAGAGFLLYLVAMPETVDSDVRVRSRPTLGGK