Protein Info for Rv2449c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 283 to 304 (22 residues), see Phobius details PF03435: Sacchrp_dh_NADP" amino acids 10 to 136 (127 residues), 44.9 bits, see alignment E=7.4e-16

Best Hits

Swiss-Prot: 100% identical to Y2449_MYCTU: Putative trans-acting enoyl reductase Rv2449c (Rv2449c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_2463)

MetaCyc: 68% identical to (phenol)phthiodiol-4-en-one enoyl reductase (Mycobacterium tuberculosis H37Rv)
1.1.1.M10 [EC: 1.1.1.M10]; 1.1.1.M10 [EC: 1.1.1.M10]; 1.1.1.M10 [EC: 1.1.1.M10]; 1.1.1.M10 [EC: 1.1.1.M10]; 1.1.1.M10 [EC: 1.1.1.M10]

Predicted SEED Role

"FIG01121868: Possible membrane protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.M10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>Rv2449c Conserved protein (Mycobacterium tuberculosis H37Rv)
VTATPREFDIVLYGATGFVGKLTAEYLARAGGDARIALAGRSTQRVLAVREALGESAQTW
PILTADASLPSTLQAMAARAQVVVTTVGPYTRYGLPLVAACAAAGTDYADLTGEPMFMRN
SIDLYHKQAADTGARIVHACGFDSVPSDLSVYALYHAAREDGAGELTDTNCVVRSFKGGF
SGGTIASMLEVLSTASNDPDARRQLSDPYMLSPDRGAEPELGPQPDLPSRRGRRLAPELA
GVWTAGFIMAPTNTRIVRRSNALLDWAYGRRFRYSETMSVGSTVLAPVVSVVGGGVGNAM
FGLASRYIRLLPRGLVKRVVPKPGTGPSAAARERGYYRIETYTTTTTGARYLARMAQDGD
PGYKATSVLLGECGLALALDRDKLSDMRGVLTPAAAMGDALLERLPAAGVSLQTTRLAS