Protein Info for Rv2434c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 112 to 135 (24 residues), see Phobius details amino acids 141 to 169 (29 residues), see Phobius details PF21088: MS_channel_1st" amino acids 117 to 158 (42 residues), 25.9 bits, see alignment 1.6e-09 PF00924: MS_channel_2nd" amino acids 159 to 225 (67 residues), 71.1 bits, see alignment E=1.3e-23 PF21082: MS_channel_3rd" amino acids 231 to 310 (80 residues), 39.3 bits, see alignment E=1.4e-13 PF00027: cNMP_binding" amino acids 353 to 438 (86 residues), 53.9 bits, see alignment E=2.9e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to mra:MRA_2460)

Predicted SEED Role

"Probable integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (481 amino acids)

>Rv2434c Probable conserved transmembrane protein (Mycobacterium tuberculosis H37Rv)
MNLLDSTWFYWAVGIAIGLPAGLIVLTELHNILVRRNSHLARQASLLRNYLLPLGAVLLL
LVKASEVPAEDPTVRVLTTAFGFLVLVLLLSLLNATLFQGAPQQSWRKRLPAIFVDVARF
ALIGIGLAVILSYIWGVRVGGLFAALGVTSVVIGLMLQNSVGQIVSGLFMLFEQPFRIDD
WLETPTARGRVVEVNWRAVHIDTGSGLQIMPNSMLATTAFTNLSRPAGAHECSITTTFST
SDPPDKVCAMLNRAASALPHVKPGVVPATIARGAAEYRTTVRLTSPADEGPTQATFLRWV
WYAARREGLHLDEADDEFSTAERVESALRTVVGPELRLSSSDQQSLARYARLVRYGTDEI
VQHAGVVPMGITFVIAGSVRLTVTTDDGSVVAIATLKKGTFLGLTALTRQPDPAGAVALE
EVTALQIGREHLEQVVMNKPMLLQELGRVIDERQRKAQQAIRRDLHQSPAAAGEHRGPAR
R