Protein Info for Rv2421c in Mycobacterium tuberculosis H37Rv

Annotation: Probable nicotinate-nucleotide adenylyltransferase NadD (deamido-NAD(+) pyrophosphorylase) (deamido-NAD(+) diphosphorylase) (nicotinate mononucleotide adenylyltransferase) (NAMN adenylyltransferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase
  • amino acids 1 to 191 (191 residues), 196.3 bits, E=5.6e-62
• PF01467: CTP_transf_like
  • amino acids 1 to 166 (166 residues), 101.7 bits, E=1.8e-33
• TIGR00125: cytidyltransferase-like domain
  • amino acids 2 to 61 (60 residues), 46.2 bits, E=4.1e-16

Best Hits

Swiss-Prot: 100% identical to NADD_MYCTU: Probable nicotinate-nucleotide adenylyltransferase (nadD) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 100% identity to mbo:Mb2444c)

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• NAD de novo biosynthesis I (6/6 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• NAD de novo biosynthesis III (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• NAD salvage pathway II (PNC IV cycle) (4/5 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• superpathway of NAD biosynthesis in eukaryotes (9/14 steps found)
• NAD de novo biosynthesis II (from tryptophan) (5/9 steps found)
• NAD salvage (plants) (5/11 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.18

Protein Sequence (211 amino acids)

>Rv2421c Probable nicotinate-nucleotide adenylyltransferase NadD (deamido-NAD(+) pyrophosphorylase) (deamido-NAD(+) diphosphorylase) (nicotinate mononucleotide adenylyltransferase) (NAMN adenylyltransferase) (Mycobacterium tuberculosis H37Rv)
MGGTFDPIHYGHLVAASEVADLFDLDEVVFVPSGQPWQKGRQVSAAEHRYLMTVIATASN
PRFSVSRVDIDRGGPTYTKDTLADLHALHPDSELYFTTGADALASIMSWQGWEELFELAR
FVGVSRPGYELRNEHITSLLGQLAKDALTLVEIPALAISSTDCRQRAEQSRPLWYLMPDG
VVQYVSKCRLYCGACDAGARSTTSLAAGNGL