Protein Info for Rv2361c in Mycobacterium tuberculosis H37Rv

Annotation: Long (C50) chain Z-isoprenyl diphosphate synthase (Z-decaprenyl diphosphate synthase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 TIGR00055: di-trans,poly-cis-decaprenylcistransferase" amino acids 67 to 294 (228 residues), 249.7 bits, see alignment E=1.2e-78 PF01255: Prenyltransf" amino acids 74 to 294 (221 residues), 256.6 bits, see alignment E=9.2e-81

Best Hits

Swiss-Prot: 100% identical to DPDS_MYCBO: Decaprenyl diphosphate synthase (uppS) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K14215, trans,polycis-decaprenyl diphosphate synthase [EC: 2.5.1.86] (inferred from 100% identity to mtb:TBMG_01614)

MetaCyc: 100% identical to trans,polycis-decaprenyl diphosphate synthase (Mycobacterium tuberculosis H37Rv)
RXN-11023 [EC: 2.5.1.86]

Predicted SEED Role

"trans,polycis-decaprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific] (EC 2.5.1.86)" (EC 2.5.1.86)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.86

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>Rv2361c Long (C50) chain Z-isoprenyl diphosphate synthase (Z-decaprenyl diphosphate synthase) (Mycobacterium tuberculosis H37Rv)
VARDARKRTSSNFPQLPPAPDDYPTFPDTSTWPVVFPELPAAPYGGPCRPPQHTSKAAAP
RIPADRLPNHVAIVMDGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAF
STENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEM
TKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLNPERITESTIARHLQRPDIPDVD
LFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA