Protein Info for Rv2343c in Mycobacterium tuberculosis H37Rv

Annotation: Probable DNA primase DnaG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 639 TIGR01391: DNA primase" amino acids 5 to 423 (419 residues), 371.6 bits, see alignment E=2.5e-115 PF01807: Zn_ribbon_DnaG" amino acids 6 to 100 (95 residues), 117.9 bits, see alignment E=5.2e-38 PF08275: DNAG_N" amino acids 127 to 255 (129 residues), 125.4 bits, see alignment E=5.4e-40 PF13662: Toprim_4" amino acids 263 to 333 (71 residues), 48.3 bits, see alignment E=3.4e-16 PF01751: Toprim" amino acids 264 to 332 (69 residues), 33.4 bits, see alignment E=1.4e-11 PF13155: Toprim_2" amino acids 265 to 355 (91 residues), 42.8 bits, see alignment E=2e-14 PF10410: DnaB_bind" amino acids 376 to 429 (54 residues), 70.2 bits, see alignment 4.9e-23 PF08278: DnaG_DnaB_bind" amino acids 487 to 614 (128 residues), 119 bits, see alignment E=5.8e-38

Best Hits

Swiss-Prot: 100% identical to DNAG_MYCTU: DNA primase (dnaG) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02316, DNA primase [EC: 2.7.7.-] (inferred from 100% identity to mbb:BCG_2366c)

Predicted SEED Role

"DNA primase (EC 2.7.7.-)" in subsystem DNA-replication or Macromolecular synthesis operon (EC 2.7.7.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (639 amino acids)

>Rv2343c Probable DNA primase DnaG (Mycobacterium tuberculosis H37Rv)
MSGRISDRDIAAIREGARIEDVVGDYVQLRRAGADSLKGLCPFHNEKSPSFHVRPNHGHF
HCFGCGEGGDVYAFIQKIEHVSFVEAVELLADRIGHTISYTGAATSVQRDRGSRSRLLAA
NAAAAAFYAQALQSDEAAPARQYLTERSFDAAAARKFGCGFAPSGWDSLTKHLQRKGFEF
EELEAAGLSRQGRHGPMDRFHRRLLWPIRTSAGEVVGFGARRLFDDDAMEAKYVNTPETL
LYKKSSVMFGIDLAKRDIAKGHQAVVVEGYTDVMAMHLAGVTTAVASCGTAFGGEHLAML
RRLMMDDSFFRGELIYVFDGDEAGRAAALKAFDGEQKLAGQSFVAVAPDGMDPCDLRLKC
GDAALRDLVARRTPLFEFAIRAAIAEMDLDSAEGRVAALRRCVPMVGQIKDPTLRDEYAR
QLAGWVGWADVAQVIGRVRGEAKRTKHPRLGRLGSTTIARAAQRPTAGPPTELAVRPDPR
DPTLWPQREALKSALQYPALAGPVFDALTVEGFTHPEYAAVRAAIDTAGGTSAGLSGAQW
LDMVRQQTTSTVTSALISELGVEAIQVDDDKLPRYIAGVLARLQEVWLGRQIAEVKSKLQ
RMSPIEQGDEYHALFGDLVAMEAYRRSLLEQASGDDLTA