Protein Info for Rv2322c in Mycobacterium tuberculosis H37Rv

Annotation: Probable ornithine aminotransferase (N-terminus part) RocD1 (ornithine--oxo-acid aminotransferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF00202: Aminotran_3" amino acids 20 to 217 (198 residues), 128.7 bits, see alignment E=1.2e-41

Best Hits

KEGG orthology group: K00819, ornithine--oxo-acid transaminase [EC: 2.6.1.13] (inferred from 100% identity to mtu:Rv2322c)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.13

Use Curated BLAST to search for 2.6.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>Rv2322c Probable ornithine aminotransferase (N-terminus part) RocD1 (ornithine--oxo-acid aminotransferase) (Mycobacterium tuberculosis H37Rv)
MTNLADATQATMALVERHAAHNYSPLPVVAASAEGAWIADIDGLRYLDWLAAYSAVNLGH
RNPASTATAHAQVDTVTLLNRALHADRLGPLGAALAQLCGKDVVLPMNSDAEAVESGLRV
ARKWGADVNGLPAGRHDIILANNNFHGHTSSVVSFSSDPAAGSGVEPSTPGLRSVPFGDA
AAPAQTIDDNTVADLLEPIPGQAGIIVPADDYLPAASSTTC