Protein Info for Rv2291 in Mycobacterium tuberculosis H37Rv

Annotation: Probable thiosulfate sulfurtransferase SseB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 237 to 257 (21 residues), see Phobius details PF00581: Rhodanese" amino acids 10 to 131 (122 residues), 60.8 bits, see alignment E=7.5e-21 amino acids 166 to 273 (108 residues), 42.5 bits, see alignment E=3.9e-15

Best Hits

Swiss-Prot: 100% identical to THT3_MYCTO: Putative thiosulfate sulfurtransferase SseB (sseB) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K01011, thiosulfate/3-mercaptopyruvate sulfurtransferase [EC: 2.8.1.1 2.8.1.2] (inferred from 99% identity to mbb:BCG_2308)

Predicted SEED Role

"Thiosulfate sulfurtransferase, rhodanese (EC 2.8.1.1)" (EC 2.8.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.1, 2.8.1.2

Use Curated BLAST to search for 2.8.1.1 or 2.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>Rv2291 Probable thiosulfate sulfurtransferase SseB (Mycobacterium tuberculosis H37Rv)
VQARGQVLITAAELAGMIQAGDPVSILDVRWRLDEPDGHAAYLQGHLPGAVFVSLEDELS
DHTIAGRGRHPLPSGASLQATVRRCGIRHDVPVVVYDDWNRAGSARAWWVLTAAGIANVR
ILDGGLPAWRSAGGSIETGQVSPQLGNVTVLHDDLYAGQRLTLTAQQAGAGGVTLLDARV
PERFRGDVEPVDAVAGHIPGAINVPSGSVLADDGTFLGNGALNALLSDHGIDHGGRVGVY
CGSGVSAAVIVAALAVIGQDAELFPGSWSEWSSDPTRPVGRGTA