Protein Info for Rv2287 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane transport protein YjcE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 54 (17 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 223 to 240 (18 residues), see Phobius details amino acids 246 to 263 (18 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 313 to 337 (25 residues), see Phobius details amino acids 358 to 379 (22 residues), see Phobius details amino acids 391 to 411 (21 residues), see Phobius details TIGR00831: Na+/H+ antiporter" amino acids 17 to 537 (521 residues), 819.9 bits, see alignment E=4.3e-251 PF00999: Na_H_Exchanger" amino acids 23 to 417 (395 residues), 214 bits, see alignment E=1.6e-67

Best Hits

Swiss-Prot: 100% identical to Y2287_MYCTU: Uncharacterized Na(+)/H(+) exchanger Rv2287 (Rv2287) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03316, monovalent cation:H+ antiporter, CPA1 family (inferred from 100% identity to mtb:TBMG_01696)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (542 amino acids)

>Rv2287 Probable conserved integral membrane transport protein YjcE (Mycobacterium tuberculosis H37Rv)
MNGRRTIGEDGLVFGLVVIVALVAAVVVGTVLGHRYRVGPPVLLILSGSLLGLIPRFGDV
QIDGEVVLLLFLPAILYWESMNTSFREIRWNLRVIVMFSIGLVIATAVAVSWTARALGME
SHAAAVLGAVLSPTDAAAVAGLAKRLPRRALTVLRGESLINDGTALVLFAVTVAVAEGAA
GIGPAALVGRFVVSYLGGIMAGLLVGGLVTLLRRRIDAPLEEGALSLLTPFAAFLLAQSL
KCSGVVAVLVSALVLTYVGPTVIRARSRLQAHAFWDIATFLINGSLWVFVGVQIPGAIDH
IAGEDGGLPRATVLALAVTGVVIATRIAWVQATTVLGHTVDRVLKKPTRHVGFRQRCVTS
WAGFRGAVSLAAALAVPMTTNSGAPFPDRNLIIFVVSVVILVTVLVQGTSLPTVVRWARM
PEDVAHANELQLARTRSAQAALDALPTVADELGVAPDLVKHLEKEYEERAVLVMADGADS
ATSDLAERNDLVRRVRLGVLQHQRQAVTTLRNQNLIDDIVLRELQAAMDLEEVQLLDPAD
AE