Protein Info for Rv2267c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details PF00685: Sulfotransfer_1" amino acids 80 to 324 (245 residues), 44.1 bits, see alignment E=1.7e-15 PF13469: Sulfotransfer_3" amino acids 82 to 324 (243 residues), 131.7 bits, see alignment E=4.9e-42

Best Hits

Swiss-Prot: 100% identical to STF3_MYCBO: PAPS-dependent sulfotransferase Stf3 (stf3) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_2278)

MetaCyc: 100% identical to omega-hydroxy-beta-dihydromenaquinone-9 sulfotransferase (Mycobacterium tuberculosis H37Rv)
RXN-16854 [EC: 2.8.2.40]

Predicted SEED Role

"FIG00821541: hypothetical protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.2.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>Rv2267c Conserved hypothetical protein (Mycobacterium tuberculosis H37Rv)
MKALRSSSRLSRWREWAAPLWVGCNFSAWMRLLIRNRFAVHHSRWHFAVLYTFLSMVNSC
LGLWQKIVFGRRVAETVIADPPIFIVGHWRTGTTLLHELLVVDDRHTGPTGYECLAPHHF
LLTEWFAPYVEFLVSKHRAMDNMDLSLHHPQEDEFVWCMQGLPSPYLTIAFPNRPPQYEE
YLDLEQVAPRELEIWKRTLFRFVQQVYFRRRKTVILKNPTHSFRIKVLLEVFPQAKFIHI
VRDPYVVYPSTIHLHKALYRIHGLQQPTFDGLDDKVVSTYVDLYRKLDEGRELVDPTRFY
ELRYEDLIGDPEGQLRRLYQHLGLGDFECYLPRLRQYLADHADYKTNSYQLTVEQRAIVD
EHWGEIIDRYGYDRHTPEPARLRPAVGG