Protein Info for Rv2249c in Mycobacterium tuberculosis H37Rv

Annotation: Probable glycerol-3-phosphate dehydrogenase GlpD1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 PF00890: FAD_binding_2" amino acids 28 to 244 (217 residues), 23.3 bits, see alignment E=5.2e-09 PF01266: DAO" amino acids 28 to 386 (359 residues), 176.6 bits, see alignment E=1.6e-55 PF16901: DAO_C" amino acids 411 to 505 (95 residues), 52.2 bits, see alignment E=8.6e-18

Best Hits

Swiss-Prot: 100% identical to GLPD1_MYCBO: Glycerol-3-phosphate dehydrogenase 1 (glpD1) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K00111, glycerol-3-phosphate dehydrogenase [EC: 1.1.5.3] (inferred from 100% identity to mtc:MT2309)

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase (EC 1.1.5.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Respiratory dehydrogenases 1 (EC 1.1.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.5.3

Use Curated BLAST to search for 1.1.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (516 amino acids)

>Rv2249c Probable glycerol-3-phosphate dehydrogenase GlpD1 (Mycobacterium tuberculosis H37Rv)
VLMPHSAALNAARRSADLTALADGGALDVIVIGGGITGVGIALDAATRGLTVALVEKHDL
AFGTSRWSSKLVHGGLRYLASGNVGIARRSAVERGILMTRNAPHLVHAMPQLVPLLPSMG
HTKRALVRAGFLAGDALRVLAGTPAATLPRSRRIPASRVVEIAPTVRRDGLDGGLLAYDG
QLIDDARLVMAVARTAAQHGARILTYVGASNVTGTSVELTDRRTRQSFALSARAVINAAG
VWAGEIDPSLRLRPSRGTHLVFDAKSFANPTAALTIPIPGELNRFVFAMPEQLGRIYLGL
TDEDAPGPIPDVPQPSSEEITFLLDTVNTALGTAVGTKDVIGAYAGLRPLIDTGGAGVQG
RTADVSRDHAVFESPSGVISVVGGKLTEYRYMAEDVLNRAITLRHLRAAKCRTRNLPLIG
APANPGPAPGSGAGLPESLVARYGAEAANVAAAATCERPTEPVADGIDVTRAEFEYAVTH
EGALDVDDILDRRTRIGLVPRDRERVVAVAKEFLSR