Protein Info for Rv2214c in Mycobacterium tuberculosis H37Rv

Annotation: Possible short-chain dehydrogenase EphD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 transmembrane" amino acids 166 to 186 (21 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 30 to 287 (258 residues), 151.2 bits, see alignment E=1.4e-47 PF12146: Hydrolase_4" amino acids 31 to 121 (91 residues), 32.3 bits, see alignment E=2.3e-11 PF12697: Abhydrolase_6" amino acids 32 to 293 (262 residues), 58.4 bits, see alignment E=6e-19 PF00106: adh_short" amino acids 327 to 514 (188 residues), 167.7 bits, see alignment E=8e-53 PF08659: KR" amino acids 329 to 479 (151 residues), 37.3 bits, see alignment E=9.8e-13 PF13561: adh_short_C2" amino acids 331 to 515 (185 residues), 141 bits, see alignment E=1.7e-44

Best Hits

Swiss-Prot: 100% identical to EPHD_MYCTO: Probable oxidoreductase EphD (ephD) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mtu:Rv2214c)

Predicted SEED Role

"Oxidoreductase, short-chain dehydrogenase/reductase family (EC 1.1.1.-)" (EC 1.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (592 amino acids)

>Rv2214c Possible short-chain dehydrogenase EphD (Mycobacterium tuberculosis H37Rv)
MPATQQMSRLVDSPDGVRIAVYHEGNPDGPTVVLVHGFPDSHVLWDGVVPLLAERFRIVR
YDNRGVGRSSVPKPISAYTMAHFADDFDAVIGELSPGEPVHVLAHDWGSVGVWEYLRRPG
ASDRVASFTSVSGPSQDHLVNYVYGGLRRPWRPRTFLRAISQTLRLSYMALFSVPVVAPL
LLRVALSSAAVRRNMVGDIPVDQIHHSETLARDAAHSVKTYPANYFRSFSSSRRGRAIPI
VDVPVQLIVNSQDPYVRPYGYDQTARWVPRLWRRDIKAGHFSPMSHPQVMAAAVHDFADL
ADGKQPSRALLRAQVGRPRGYFGDTLVSVTGAGSGIGRETALAFAREGAEIVISDIDEAT
VKDTAAEIAARGGIAYPYVLDVSDAEAVEAFAERVSAEHGVPDIVVNNAGIGQAGRFLDT
PAEQFDRVLAVNLGGVVNGCRAFGQRLVERGTGGHIVNVSSMAAYAPLQSLSAYCTSKAA
TYMFSDCLRAELDAAGVGLTTICPGVIDTNIVATTGFHAPGTDEEKIDGRRGQIDKMFAL
RSYGPDKVADAIVSAVKKKKPIRPVAPEAYALYGISRVLPQALRSTARLRVI