Protein Info for Rv2194 in Mycobacterium tuberculosis H37Rv

Annotation: Probable ubiquinol-cytochrome C reductase QcrC (cytochrome C subunit)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details transmembrane" amino acids 259 to 278 (20 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 62 to 136 (75 residues), 28.1 bits, see alignment E=2.1e-10 amino acids 163 to 235 (73 residues), 35.5 bits, see alignment E=1e-12 PF00034: Cytochrom_C" amino acids 64 to 137 (74 residues), 34.9 bits, see alignment E=3.2e-12

Best Hits

Swiss-Prot: 100% identical to QCRC_MYCBO: Cytochrome bc1 complex cytochrome c subunit (qcrC) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K03889, ubiquinol-cytochrome c reductase cytochrome c subunit (inferred from 100% identity to mtc:MT2250)

Predicted SEED Role

"ubiquinol cytochrome C oxidoreductase, cytochrome C1 subunit" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>Rv2194 Probable ubiquinol-cytochrome C reductase QcrC (cytochrome C subunit) (Mycobacterium tuberculosis H37Rv)
LTKLGFTRSGGSKSGRTRRRLRRRLSGGVLLLIALTIAGGLAAVLTPTPQVAVADESSSA
LLRTGKQLFDTSCVSCHGANLQGVPDHGPSLIGVGEAAVYFQVSTGRMPAMRGEAQAPRK
DPIFDEAQIDAIGAYVQANGGGPTVVRNPDGSIATQSLRGNDLGRGGDLFRLNCASCHNF
TGKGGALSSGKYAPDLAPANEQQILTAMLTGPQNMPKFSNRQLSFEAKKDIIAYVKVATE
ARQPGGYLLGGFGPAPEGMAMWIIGMVAAIGLALWIGARS