Protein Info for Rv2170 in Mycobacterium tuberculosis H37Rv

Annotation: GCN5-related N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 PF08445: FR47" amino acids 104 to 184 (81 residues), 29.4 bits, see alignment E=9.9e-11 PF00583: Acetyltransf_1" amino acids 124 to 181 (58 residues), 24.3 bits, see alignment E=4.7e-09 PF13508: Acetyltransf_7" amino acids 125 to 182 (58 residues), 28.2 bits, see alignment E=3.1e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_12198)

Predicted SEED Role

"Acetyltransferase (EC 2.3.1.-)" (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>Rv2170 GCN5-related N-acetyltransferase (Mycobacterium tuberculosis H37Rv)
LAIFLIDLPPSDMERRLGDALTVYVDAMRYPRGTETLRAPMWLEHIRRRGWQAVAAVEVT
AAEQAEAADTTALPSAAELSNAPMLGVAYGYPGAPGQWWQQQVVLGLQRSGFPRLAIARL
MTSYFELTELHILPRAQGRGLGEALARRLLAGRDEDNVLLSTPETNGEDNRAWRLYRRLG
FTDIIRGYHFAGDPRAFAILGRTLPL