Protein Info for Rv2152c in Mycobacterium tuberculosis H37Rv

Annotation: Probable UDP-N-acetylmuramate-alanine ligase MurC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 TIGR01082: UDP-N-acetylmuramate--L-alanine ligase" amino acids 13 to 474 (462 residues), 540.7 bits, see alignment E=1.6e-166 PF01225: Mur_ligase" amino acids 13 to 115 (103 residues), 86.3 bits, see alignment E=2.3e-28 PF08245: Mur_ligase_M" amino acids 120 to 309 (190 residues), 87.6 bits, see alignment E=1.7e-28 PF02875: Mur_ligase_C" amino acids 331 to 465 (135 residues), 70.6 bits, see alignment E=3.4e-23

Best Hits

Swiss-Prot: 100% identical to MURC_MYCTO: UDP-N-acetylmuramate--L-alanine ligase (murC) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K01924, UDP-N-acetylmuramate--alanine ligase [EC: 6.3.2.8] (inferred from 100% identity to mbo:Mb2176c)

MetaCyc: 100% identical to UDP-N-acetylmuramate--L-alanine ligase (Mycobacterium tuberculosis H37Rv)
UDP-N-acetylmuramate--L-alanine ligase. [EC: 6.3.2.8]

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (494 amino acids)

>Rv2152c Probable UDP-N-acetylmuramate-alanine ligase MurC (Mycobacterium tuberculosis H37Rv)
VSTEQLPPDLRRVHMVGIGGAGMSGIARILLDRGGLVSGSDAKESRGVHALRARGALIRI
GHDASSLDLLPGGATAVVTTHAAIPKTNPELVEARRRGIPVVLRPAVLAKLMAGRTTLMV
TGTHGKTTTTSMLIVALQHCGLDPSFAVGGELGEAGTNAHHGSGDCFVAEADESDGSLLQ
YTPHVAVITNIESDHLDFYGSVEAYVAVFDSFVERIVPGGALVVCTDDPGGAALAQRATE
LGIRVLRYGSVPGETMAATLVSWQQQGVGAVAHIRLASELATAQGPRVMRLSVPGRHMAL
NALGALLAAVQIGAPADEVLDGLAGFEGVRRRFELVGTCGVGKASVRVFDDYAHHPTEIS
ATLAAARMVLEQGDGGRCMVVFQPHLYSRTKAFAAEFGRALNAADEVFVLDVYGAREQPL
AGVSGASVAEHVTVPMRYVPDFSAVAQQVAAAASPGDVIVTMGAGDVTLLGPEILTALRV
RANRSAPGRPGVLG