Protein Info for Rv2150c in Mycobacterium tuberculosis H37Rv

Annotation: Cell division protein FtsZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 TIGR00065: cell division protein FtsZ" amino acids 8 to 314 (307 residues), 417.5 bits, see alignment E=2.7e-129 PF00091: Tubulin" amino acids 11 to 169 (159 residues), 167.2 bits, see alignment E=5.5e-53 PF12327: FtsZ_C" amino acids 219 to 313 (95 residues), 121 bits, see alignment E=2.2e-39

Best Hits

Swiss-Prot: 100% identical to FTSZ_MYCTA: Cell division protein FtsZ (ftsZ) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K03531, cell division protein FtsZ (inferred from 100% identity to mbt:JTY_2161)

Predicted SEED Role

"Cell division protein FtsZ (EC 3.4.24.-)" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>Rv2150c Cell division protein FtsZ (Mycobacterium tuberculosis H37Rv)
MTPPHNYLAVIKVVGIGGGGVNAVNRMIEQGLKGVEFIAINTDAQALLMSDADVKLDVGR
DSTRGLGAGADPEVGRKAAEDAKDEIEELLRGADMVFVTAGEGGGTGTGGAPVVASIARK
LGALTVGVVTRPFSFEGKRRSNQAENGIAALRESCDTLIVIPNDRLLQMGDAAVSLMDAF
RSADEVLLNGVQGITDLITTPGLINVDFADVKGIMSGAGTALMGIGSARGEGRSLKAAEI
AINSPLLEASMEGAQGVLMSIAGGSDLGLFEINEAASLVQDAAHPDANIIFGTVIDDSLG
DEVRVTVIAAGFDVSGPGRKPVMGETGGAHRIESAKAGKLTSTLFEPVDAVSVPLHTNGA
TLSIGGDDDDVDVPPFMRR