Protein Info for Rv2110c in Mycobacterium tuberculosis H37Rv

Annotation: Proteasome beta subunit PrcB; assembles with alpha subunit PrcA.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 TIGR03690: proteasome, beta subunit" amino acids 54 to 279 (226 residues), 356.1 bits, see alignment E=4e-111 PF00227: Proteasome" amino acids 56 to 240 (185 residues), 101.7 bits, see alignment E=2.1e-33

Best Hits

Swiss-Prot: 100% identical to PSB_MYCTO: Proteasome subunit beta (prcB) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03433, proteasome beta subunit [EC: 3.4.25.1] (inferred from 100% identity to mbo:Mb2134c)

Predicted SEED Role

"Proteasome subunit beta (EC 3.4.25.1), bacterial" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Proteasome archaeal (EC 3.4.25.1)

Isozymes

Compare fitness of predicted isozymes for: 3.4.25.1

Use Curated BLAST to search for 3.4.25.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>Rv2110c Proteasome beta subunit PrcB; assembles with alpha subunit PrcA. (Mycobacterium tuberculosis H37Rv)
VTWPLPDRLSINSLSGTPAVDLSSFTDFLRRQAPELLPASISGGAPLAGGDAQLPHGTTI
VALKYPGGVVMAGDRRSTQGNMISGRDVRKVYITDDYTATGIAGTAAVAVEFARLYAVEL
EHYEKLEGVPLTFAGKINRLAIMVRGNLAAAMQGLLALPLLAGYDIHASDPQSAGRIVSF
DAAGGWNIEEEGYQAVGSGSLFAKSSMKKLYSQVTDGDSGLRVAVEALYDAADDDSATGG
PDLVRGIFPTAVIIDADGAVDVPESRIAELARAIIESRSGADTFGSDGGEK