Protein Info for Rv2070c in Mycobacterium tuberculosis H37Rv

Annotation: Precorrin-6X reductase CobK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details TIGR00715: precorrin-6x reductase" amino acids 2 to 242 (241 residues), 320.1 bits, see alignment E=5.9e-100 PF02571: CbiJ" amino acids 3 to 238 (236 residues), 248.3 bits, see alignment E=3.9e-78

Best Hits

Swiss-Prot: 100% identical to COBK_MYCTU: Precorrin-6A reductase (cobK) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K05895, precorrin-6X reductase [EC: 1.3.1.54] (inferred from 100% identity to mra:MRA_2084)

Predicted SEED Role

"Cobalt-precorrin-6x reductase (EC 1.3.1.54)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 1.3.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>Rv2070c Precorrin-6X reductase CobK (Mycobacterium tuberculosis H37Rv)
VTRVLLLGGTAEGRALAKELHPHVEIVSSLAGRVPNPALPIGPVRIGGFGGVEGLRGWLR
EERIDAVVDATHPFAVTITAHAAQVCGELGLPYLVLARPPWDPGTAIIAVSDIEAADVVA
EQGYSRVFLTTGRSGIAAFANSDAWFLIRVVTAPDGTALPRRHKLVLSRGPYGYHDEFAL
LREQRIDALVTKNSGGKMTRAKLDAAAALGISVVMIARPLLPAGVAAVDSVHRAAMWVAG
LPSR