Protein Info for Rv2056c in Mycobacterium tuberculosis H37Rv

Annotation: 30S ribosomal protein S14 RpsN2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 PF00253: Ribosomal_S14" amino acids 48 to 100 (53 residues), 82.2 bits, see alignment E=8.3e-28

Best Hits

Swiss-Prot: 99% identical to RS14_MYCBO: 30S ribosomal protein S14 (rpsN) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K02954, small subunit ribosomal protein S14 (inferred from 99% identity to mbt:JTY_2070)

MetaCyc: 46% identical to 30S ribosomal subunit protein S14 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S14p (S29e) @ SSU ribosomal protein S14p (S29e), zinc-independent"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (101 amino acids)

>Rv2056c 30S ribosomal protein S14 RpsN2 (Mycobacterium tuberculosis H37Rv)
VAKKSKIVKNQRRAATVARYASRRTALKDIIRSPSSAPEQRSTAQRALARQPRDASPVRL
RNRDAIDGRPRGHLRKFGLSRVRVRQLAHDGHLPGVRKASW