Protein Info for Rv2027c in Mycobacterium tuberculosis H37Rv

Annotation: Two component sensor histidine kinase DosT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 573 PF01590: GAF" amino acids 62 to 198 (137 residues), 60.6 bits, see alignment E=5.9e-20 amino acids 231 to 365 (135 residues), 31.3 bits, see alignment E=6.8e-11 PF13185: GAF_2" amino acids 62 to 199 (138 residues), 66.4 bits, see alignment E=7.9e-22 PF13492: GAF_3" amino acids 317 to 365 (49 residues), 35 bits, see alignment 4.5e-12 PF07730: HisKA_3" amino acids 384 to 445 (62 residues), 42.5 bits, see alignment E=1.9e-14 PF02518: HATPase_c" amino acids 489 to 572 (84 residues), 37.6 bits, see alignment E=6.9e-13

Best Hits

Swiss-Prot: 100% identical to DOST_MYCTU: Oxygen sensor histidine kinase response regulator DosT (dosT) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mra:MRA_2042)

Predicted SEED Role

"TWO COMPONENT SENSOR HISTIDINE KINASE DEVS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (573 amino acids)

>Rv2027c Two component sensor histidine kinase DosT (Mycobacterium tuberculosis H37Rv)
VTHPDRANVNPGSPPLRETLSQLRLRELLLEVQDRIEQIVEGRDRLDGLIDAILAITSGL
KLDATLRAIVHTAAELVDARYGALGVRGYDHRLVEFVYEGIDEETRHLIGSLPEGRGVLG
ALIEEPKPIRLDDISRHPASVGFPLHHPPMRTFLGVPVRIRDEVFGNLYLTEKADGQPFS
DDDEVLVQALAAAAGIAVDNARLFEESRTREAWIEATRDIGTQMLAGADPAMVFRLIAEE
ALTLMAGAATLVAVPLDDEAPACEVDDLVIVEVAGEISPAVKQMTVAVSGTSIGGVFHDR
TPRRFDRLDLAVDGPVEPGPALVLPLRAADTVAGVLVALRSADEQPFSDKQLDMMAAFAD
QAALAWRLATAQRQMREVEILTDRDRIARDLHDHVIQRLFAVGLTLQGAAPRARVPAVRE
SIYSSIDDLQEIIQEIRSAIFDLHAGPSRATGLRHRLDKVIDQLAIPALHTTVQYTGPLS
VVDTVLANHAEAVLREAVSNAVRHANATSLAINVSVEDDVRVEVVDDGVGISGDITESGL
RNLRQRADDAGGEFTVENMPTGGTLLRWSAPLR