Protein Info for Rv2025c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 48 to 71 (24 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details amino acids 212 to 229 (18 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 42 to 319 (278 residues), 249.7 bits, see alignment E=1.7e-78 PF01545: Cation_efflux" amino acids 45 to 237 (193 residues), 158.6 bits, see alignment E=1.8e-50 PF16916: ZT_dimer" amino acids 241 to 317 (77 residues), 55.6 bits, see alignment E=4.7e-19

Best Hits

Swiss-Prot: 100% identical to Y2025_MYCTU: Probable cation efflux system protein Rv2025c (Rv2025c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtc:MT2084)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>Rv2025c Conserved membrane protein (Mycobacterium tuberculosis H37Rv)
MTHDHAHSRGVPAMIKEIFAPHSHDAADSVDDTLESTAAGIRTVKISLLVLGLTALIQIV
IVVMSGSVALAADTIHNFADALTAVPLWIAFALGAKPATRRYTYGFGRVEDLAGSFVVAM
ITMSAIIAGYEAIARLIHPQQIEHVGWVALAGLVGFIGNEWVALYRIRVGHRIGSAALIA
DGLHARTDGFTSLAVLCSAGGVALGFPLADPIVGLLITAAILAVLRTAARDVFRRLLDGV
DPAMVDAAEQALAARPGVQAVRSVRMRWIGHRLHADAELDVDPALDLAQAHRIAHDAEHE
LTHTVPKLTTALIHAYPAEHGSSIPDRGRTVE