Protein Info for Rv2021c in Mycobacterium tuberculosis H37Rv

Annotation: Transcriptional regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 PF13744: HTH_37" amino acids 33 to 92 (60 residues), 40.1 bits, see alignment E=4e-14 PF13560: HTH_31" amino acids 34 to 84 (51 residues), 36.4 bits, see alignment E=8.1e-13 PF01381: HTH_3" amino acids 35 to 88 (54 residues), 41.7 bits, see alignment E=1.5e-14

Best Hits

Swiss-Prot: 100% identical to HIGA2_MYCTU: Putative antitoxin HigA2 (higA2) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mbb:BCG_2038c)

Predicted SEED Role

"Transcriptional regulator, XRE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (101 amino acids)

>Rv2021c Transcriptional regulatory protein (Mycobacterium tuberculosis H37Rv)
MAMTLRDMDAVRPVNREAVDRHKARMRDEVRAFRLRELRAAQSLTQVQVAALAHIRQSRV
SSIENGDIGSAQVNTLRKYVSALGGELDITVRLGDETFTLA