Protein Info for Rv2002 in Mycobacterium tuberculosis H37Rv

Annotation: Possible 20-beta-hydroxysteroid dehydrogenase FabG3 (cortisone reductase) ((R)-20-hydroxysteroid dehydrogenase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF00106: adh_short" amino acids 8 to 193 (186 residues), 192.1 bits, see alignment E=1.1e-60 PF08659: KR" amino acids 10 to 164 (155 residues), 38 bits, see alignment E=2.5e-13 PF13561: adh_short_C2" amino acids 16 to 237 (222 residues), 204.5 bits, see alignment E=3e-64

Best Hits

Swiss-Prot: 100% identical to HSD_MYCBO: 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase (fabG3) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K00038, 3alpha(or 20beta)-hydroxysteroid dehydrogenase [EC: 1.1.1.53] (inferred from 100% identity to mtc:MT2058)

MetaCyc: 47% identical to cyclopentanol dehydrogenase (Comamonas sp. NCIMB 9872)
Cyclopentanol dehydrogenase. [EC: 1.1.1.163]

Predicted SEED Role

"3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase (EC 1.1.1.53)" (EC 1.1.1.53)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.163 or 1.1.1.53

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>Rv2002 Possible 20-beta-hydroxysteroid dehydrogenase FabG3 (cortisone reductase) ((R)-20-hydroxysteroid dehydrogenase) (Mycobacterium tuberculosis H37Rv)
MSGRLIGKVALVSGGARGMGASHVRAMVAEGAKVVFGDILDEEGKAVAAELADAARYVHL
DVTQPAQWTAAVDTAVTAFGGLHVLVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGI
RAVVKPMKEAGRGSIINISSIEGLAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNS
IHPGLVKTPMTDWVPEDIFQTALGRAAEPVEVSNLVVYLASDESSYSTGAEFVVDGGTVA
GLAHNDFGAVEVSSQPEWVT