Protein Info for Rv2000 in Mycobacterium tuberculosis H37Rv

Annotation: Unknown protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 PF13450: NAD_binding_8" amino acids 79 to 117 (39 residues), 24 bits, see alignment 1.9e-09

Best Hits

Swiss-Prot: 100% identical to Y2023_MYCBO: Uncharacterized protein Mb2023 (BQ2027_MB2023) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 100% identity to mbo:Mb2023)

Predicted SEED Role

"FIG029313: hypothetical protein Rv2000/MT2056"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (537 amino acids)

>Rv2000 Unknown protein (Mycobacterium tuberculosis H37Rv)
MRPGFVGLGFGQWPVYVVRWPKLHLTPRQRKRVLHRRRLLTDRPISLSQIPIRTGGPMND
PWPRPTQGPAKTIETDYLVIGAGAMGMAFTDTLITESGARVVMIDRACQPGGHWTTAYPF
VRLHQPSAYYGVNSRALGNNTIDLVGWNQGLNELAPVGEICAYFDAVLQQQLLPTGRVDY
FPMSEYLGDGRFRTLAGTEYVVTVNRRIVDATYLRAVVPSMRPAPYSVAPGVDCVAPNEL
PKLGTRDRYVVVGAGKTGMDVCLWLLRNDVCPDKLTWIMPRDSWLIDRATLQPGPTFVRQ
FRESYGATLEAIGAATSTDDLFDRLETAGTLLRIDPSVRPSMYRCATVSHLELEQLRRIR
DIVRMGHVQRIEPTTIVLDGGSVPATPTALYIDCTADGAPQRPAKPVFDADHLTLQAVRG
CQQVFSAAFIAHVEFAYEDDAVKNELCTPIPHPDCDLDWMRLMHSDLGNFQRWLNDPDLT
DWLSSARLNLLADLLPPLSHKPRVRERVVSMFQKRLGTAGDQLAKLLDAATATTEQR