Protein Info for Rv1999c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 94 to 120 (27 residues), see Phobius details amino acids 126 to 143 (18 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 272 to 299 (28 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details amino acids 347 to 369 (23 residues), see Phobius details amino acids 378 to 394 (17 residues), see Phobius details amino acids 400 to 418 (19 residues), see Phobius details PF13520: AA_permease_2" amino acids 18 to 403 (386 residues), 151.2 bits, see alignment E=4.5e-48 PF00324: AA_permease" amino acids 23 to 344 (322 residues), 122.1 bits, see alignment E=2.8e-39

Best Hits

Swiss-Prot: 100% identical to Y2022_MYCBO: Uncharacterized transporter Mb2022c (BQ2027_MB2022C) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K03294, basic amino acid/polyamine antiporter, APA family (inferred from 100% identity to mtf:TBFG_12031)

Predicted SEED Role

"putative amino acid transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>Rv1999c Probable conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
MRRPLDPRDIPDELRRRLGLLDAVVIGLGSMIGAGIFAALAPAAYAAGSGLLLGLAVAAV
VAYCNAISSARLAARYPASGGTYVYGRMRLGDFWGYLAGWGFVVGKTASCAAMALTVGFY
VWPAQAHAVAVAVVVALTAVNYAGIQKSAWLTRSIVAVVLVVLTAVVVAAYGSGAADPAR
LDIGVDAHVWGMLQAAGLLFFAFAGYARIATLGEEVRDPARTIPRAIPLALGITLAVYAL
VAVAVIAVLGPQRLARAAAPLSEAMRVAGVNWLIPVVQIGAAVAALGSLLALILGVSRTT
LAMARDRHLPRWLAAVHPRFKVPFRAELVVGAVVAALAATADIRGAIGFSSFGVLVYYAI
ANASALTLGLDEGRPRRLIPLVGLIGCVVLAFALPLSSVAAGAAVLGVGVAAYGVRRIIT
RRARQTDSGDTQRSGHPSAT