Protein Info for Rv1985c in Mycobacterium tuberculosis H37Rv

Annotation: Probable transcriptional regulatory protein (probably LysR-family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 TIGR03298: transcriptional regulator, ArgP family" amino acids 6 to 290 (285 residues), 378.7 bits, see alignment E=8e-118 PF00126: HTH_1" amino acids 10 to 65 (56 residues), 64.7 bits, see alignment E=5.9e-22 PF03466: LysR_substrate" amino acids 95 to 263 (169 residues), 39.8 bits, see alignment E=3.3e-14

Best Hits

Swiss-Prot: 100% identical to Y2007_MYCBO: Uncharacterized HTH-type transcriptional regulator Mb2007c (BQ2027_MB2007C) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K05596, LysR family transcriptional regulator, chromosome initiation inhibitor (inferred from 100% identity to mtc:MT2039)

Predicted SEED Role

"Transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>Rv1985c Probable transcriptional regulatory protein (probably LysR-family) (Mycobacterium tuberculosis H37Rv)
MVDPQLDGPQLAALAAVVELGSFDAAAERLHVTPSAVSQRIKSLEQQVGQVLVVREKPCR
ATTAGIPLLRLAAQTALLESEALAEMGGNASLKRTRITIAVNADSMATWFSAVFDGLGDV
LLDVRIEDQDHSARLLREGVAMGAVTTERNPVPGCRVHPLGEMRYLPVASRPFVQRHLSD
GFTAAAAAKAPSLAWNRDDGLQDMLVRKAFRRAITRPTHFVPTTEGFTAAARAGLGWGMF
PEKLAASPLADGSFVRVCDIHLDVPLYWQCWKLDSPIIARITDTVRAAASGLYRGQQRRR
RPG