Protein Info for Rv1935c in Mycobacterium tuberculosis H37Rv

Annotation: Possible enoyl-CoA hydratase EchA13 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 144 to 161 (18 residues), see Phobius details PF00378: ECH_1" amino acids 36 to 93 (58 residues), 44.6 bits, see alignment E=1.2e-15 amino acids 110 to 262 (153 residues), 81.7 bits, see alignment E=5.4e-27 PF16113: ECH_2" amino acids 38 to 244 (207 residues), 56.9 bits, see alignment E=2.6e-19

Best Hits

Swiss-Prot: 100% identical to ECH13_MYCTU: Putative enoyl-CoA hydratase EchA13 (echA13) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 100% identity to mtb:TBMG_02057)

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>Rv1935c Possible enoyl-CoA hydratase EchA13 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase) (Mycobacterium tuberculosis H37Rv)
MFVGRVGPVDRRSDGERSRRPREFEYIRYETIDDGRIAAITLDRPKQRNAQTRGMLVELG
AAFELAEADDTVRVVILRAAGPAFSAGHDLGSADDIRERSPGPDQHPSYRCNGATFGGVE
SRNRQEWHYYFENTKRWRNLRKITIAQVHGAVLSAGLMLAWCCDLIVASEDTVFADVVGT
RLGMCGVEYFGHPWEFGPRKTKELLLTGDCIGADEAHALGMVSKVFPADELATSTIEFAR
RIAKVPTMAALLIKESVNQTVDAMGFSAALDGCFKIHQLNHAHWGEVTGGKLSYGTVEYG
LEDWRAAPQIRPAIKQRP