Protein Info for Rv1926c in Mycobacterium tuberculosis H37Rv

Annotation: Immunogenic protein Mpt63 (antigen Mpt63/MPB63) (16 kDa immunoprotective extracellular protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF09167: DUF1942" amino acids 32 to 157 (126 residues), 172.2 bits, see alignment E=2.4e-55

Best Hits

Swiss-Prot: 100% identical to MP63_MYCBO: Immunogenic protein MPB63 (mpb63) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 100% identity to mtc:MT1977)

Predicted SEED Role

"Immunogenic protein MPT63/MPB63 precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>Rv1926c Immunogenic protein Mpt63 (antigen Mpt63/MPB63) (16 kDa immunoprotective extracellular protein) (Mycobacterium tuberculosis H37Rv)
MKLTTMIKTAVAVVAMAAIATFAAPVALAAYPITGKLGSELTMTDTVGQVVLGWKVSDLK
SSTAVIPGYPVAGQVWEATATVNAIRGSVTPAVSQFNARTADGINYRVLWQAAGPDTISG
ATIPQGEQSTGKIYFDVTGPSPTIVAMNNGMEDLLIWEP