Protein Info for Rv1918c in Mycobacterium tuberculosis H37Rv

Annotation: PPE family protein PPE35

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 987 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 152 to 170 (19 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details PF00823: PPE" amino acids 3 to 166 (164 residues), 204.5 bits, see alignment E=1.2e-64 PF01469: Pentapeptide_2" amino acids 309 to 346 (38 residues), 30.5 bits, see alignment (E = 2.7e-11) amino acids 317 to 355 (39 residues), 37.5 bits, see alignment (E = 1.8e-13) amino acids 337 to 376 (40 residues), 34.1 bits, see alignment (E = 2e-12) amino acids 357 to 395 (39 residues), 46.8 bits, see alignment (E = 2.3e-16) amino acids 398 to 435 (38 residues), 37.2 bits, see alignment (E = 2.2e-13) amino acids 407 to 444 (38 residues), 32 bits, see alignment (E = 9.4e-12)

Best Hits

KEGG orthology group: None (inferred from 85% identity to mtc:MT1969)

Predicted SEED Role

"PPE family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (987 amino acids)

>Rv1918c PPE family protein PPE35 (Mycobacterium tuberculosis H37Rv)
MHYSVLPPEINSALIFAGAGSGPMLAAASAWDGLATELASAAVSFGSVTAGLVGGSWQGR
SSVAMAAAAAPYAGWLAAAATQAEQAATQAQVMVAEFEAVRLAMVQPALVAANRSGLISL
VISNLFGQNAPAIAAAEAAYEEMWALDVSAMAAYHSGASAVAVALPAFALPLRLPAGLAA
GPAAVVTALTTAVGMPTFAGRAIAASLGLANVGGGNLGNANNGLGNIGNANLGNNNLGSG
NFGSFNIGSANLGGNNIGIGNAGANNFGLANLGNLNTGFANAGIGNFGIANTGNNNIGNG
LTGNNQIGIGGLNSGNGNVGLFNAGSANIGFFNSGNGNFGIGNSGNFSTGLFNPGHGNTG
FLNAGSFNTGMFDVGNANTGSFNVGHYNFGAFNPGPSNTGTFNTGGANTGWFNTGSINTG
AFNIGDMNNGLFNTGDMNNGVFYRGVGQGSLQFAITSPDLTLPSLEIPGISVPAFSLPAI
TLPSLTIPAVTTPANVTVGAFDLPGLTVPSLTIPAAMTPANITVGAFDLPGLTVPSLTIP
ATTTPANITVGAFNLPQLSIPSVTVPPITIPAGTALGAFNLPTLSIPSVTVPPITIPAGT
TVGGFTLPTIHTPLISTPQISIGGFSTPGIATQANSGVINLPTFSLNGITITNLVVFIPN
NITALQTNMPGVFPQIGGFANTPPAFINTGTITVGGGQINGVGFSIGAINVTPFTLPNVV
IQPWSLGGISVDGFTLPEISTQEFTTPALTISPIGVGALSLPDITTQQFTTPELTIDPIT
LGGFTLPQLSIPAITTPAFTIDPIALGGFTLPQIMTPEITTPPFAIDPIGLSGFTLPQVN
IPEITTPEFTIQPVGLAAFTTPALTIASIHLPSTTMGGFAIPAGPGYFNSSATPSLGFFN
AGIGGNSGFGNSGSGLSGWFNTSPVGLLAGSGYQNYGGLISGFSNLGSGISGFANTGTLP
FAVTSLVSGLANIGNNLSGLFFQSTTP