Protein Info for Rv1905c in Mycobacterium tuberculosis H37Rv

Annotation: Probable D-amino acid oxidase Aao

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF01266: DAO" amino acids 8 to 315 (308 residues), 134.2 bits, see alignment E=8.7e-43 PF00890: FAD_binding_2" amino acids 8 to 57 (50 residues), 26.2 bits, see alignment 4.6e-10

Best Hits

Swiss-Prot: 100% identical to DAO_MYCTO: Probable D-amino-acid oxidase (aao) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00273, D-amino-acid oxidase [EC: 1.4.3.3] (inferred from 99% identity to mbt:JTY_1928)

Predicted SEED Role

"D-amino-acid oxidase (EC 1.4.3.3)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 1.4.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>Rv1905c Probable D-amino acid oxidase Aao (Mycobacterium tuberculosis H37Rv)
VAIGEQQVIVIGAGVSGLTSAICLAEAGWPVRVWAAALPQQTTSAVAGAVWGPRPKEPVA
KVRGWIEQSLHVFRDLAKDPATGVRMTPALSVGDRIETGAMPPGLELIPDVRPADPADVP
GGFRAGFHATLPMIDMPQYLDCLTQRLAATGCEIETRPLRSLAEAAEAAPIVINCAGLGA
RELAGDATVWPRFGQHVVLTNPGLEQLFIERTGGSEWICYFAHPQRVVCGGISIPGRWDP
TPEPEITERILQRCRRIQPRLAEAAVIETITGLRPDRPSVRVEAEPIGRALCIHNYGHGG
DGVTLSWGCAREVVNLVGGG