Protein Info for Rv1896c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 TIGR00027: methyltransferase, TIGR00027 family" amino acids 24 to 279 (256 residues), 288 bits, see alignment E=3.3e-90 PF04072: LCM" amino acids 26 to 201 (176 residues), 205.4 bits, see alignment E=3.7e-65

Best Hits

Swiss-Prot: 100% identical to Y1931_MYCBO: Putative S-adenosyl-L-methionine-dependent methyltransferase Mb1931c (BQ2027_MB1931C) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_02096)

Predicted SEED Role

"Putative S-adenosyl-L-methionine-dependent methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>Rv1896c Conserved hypothetical protein (Mycobacterium tuberculosis H37Rv)
MTTPEYGSLRSDDDHWDIVSNVGYTALLVAGWRALHTTGPKPLVQDEYAKHFITASADPY
LEGLLANPRTSEDGTAFPRLYGVQTRFFDDFFNCADEAGIRQAVIVAAGLDCRAYRLDWQ
PGTTVFEIDVPKVLEFKARVLSERGAVPKAHRVAVPADLRTDWPTPLTAAGFDPQRPSAW
SVEGLLPYLTGDAQYALFARIDELCAPGSRVALGALGSRLDHEQLAALETAHPGVNMSGD
VNFSALTYDDKTDPVEWLVEHGWAVDPVRSTLELQVGYGLTPPDVDVKIDSFMRSQYITA
VRA