Protein Info for Rv1869c in Mycobacterium tuberculosis H37Rv

Annotation: Probable reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 7 to 304 (298 residues), 240.1 bits, see alignment E=1.6e-74 PF13738: Pyr_redox_3" amino acids 71 to 278 (208 residues), 31.7 bits, see alignment E=4.6e-11 PF00070: Pyr_redox" amino acids 149 to 228 (80 residues), 63.7 bits, see alignment E=8.3e-21 PF14759: Reductase_C" amino acids 326 to 408 (83 residues), 47.9 bits, see alignment E=7.1e-16

Best Hits

Swiss-Prot: 41% identical to THCD_RHOER: Rhodocoxin reductase (thcD) from Rhodococcus erythropolis

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to mbb:BCG_1905c)

MetaCyc: 38% identical to NADH-putidaredoxin reductase (Pseudomonas putida ATCC 17453)
RXN-13138 [EC: 1.18.1.5]

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.18.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>Rv1869c Probable reductase (Mycobacterium tuberculosis H37Rv)
MASSTTFVIVGGGLAGAKAVEALRRSDFGGRIILFGDEEHLPYDRPPLSKEFLAGKKSLS
DFTIQTSDWYRDHDVDVRLGVRVSSLDRSAHTVELPDGAAVRYDKLLLATGSAPRRPPIP
GSDAAGVHYLRSYNDAVALNSVLVQGSSLAVVGAGWIGLEVAASARQRGVDVTVVETAIQ
PLLAALGEAVGKVFADLHRDQGVDLRLQTQLEEITAADGKATGLKMRDGSTVAADAVLVA
VGAKPNVELAQQAGLAMGEGGVLVDASLRTSDPDIYAVGDIAAAEHPLLGTRVRTEHWAN
ALKQPAVAAAGMLGRPGEYAELPYLFTDQYDLGMEYVGHAPSCDRVVFRGNVAGREFLSF
WLDGDSRVLAGMNVNVWDVVDDVKGLIRSGNPVDVDRLVDPQWPLADLTTN