Protein Info for Rv1852 in Mycobacterium tuberculosis H37Rv

Annotation: Urease accessory protein UreG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00101: urease accessory protein UreG
  • amino acids 26 to 219 (194 residues), 273 bits, E=7.4e-86
• PF02492: cobW
  • amino acids 28 to 197 (170 residues), 127.4 bits, E=2.6e-41

Best Hits

Swiss-Prot: 100% identical to UREG_MYCBO: Urease accessory protein UreG (ureG) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K03189, urease accessory protein (inferred from 100% identity to mra:MRA_1863)

MetaCyc: 56% identical to urease accessory protein GTPase UreG (Helicobacter pylori 26695)

Predicted SEED Role

"Urease accessory protein UreG" in subsystem Urea decomposition

MetaCyc Pathways

• urea degradation II (1/1 steps found)
• superpathway of allantoin degradation in plants (1/8 steps found)

Protein Sequence (224 amino acids)

>Rv1852 Urease accessory protein UreG (Mycobacterium tuberculosis H37Rv)
MATHSHPHSHTVPARPRRVRKPGEPLRIGVGGPVGSGKTALVAALCRQLRGELSLAVLTN
DIYTTEDADFLRTHAVLPDDRIAAVQTGGCPHTAIRDDITANLDAIDELMAAHDALDLIL
VESGGDNLTATFSSGLVDAQIFVIDVAGGDKVPRKGGPGVTYSDLLVVNKTDLAALVGAD
LAVMARDADAVRDGRPTVLQSLTEDPAASDVVAWVRSQLAADGV